Anti-EIF5
Artikelnummer:
ATA-HPA000867
- Bilder (7)
| Artikelname: | Anti-EIF5 |
| Artikelnummer: | ATA-HPA000867 |
| Hersteller Artikelnummer: | HPA000867 |
| Alternativnummer: | ATA-HPA000867-100,ATA-HPA000867-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ICC, IHC, WB |
| Spezies Reaktivität: | Human, Mouse, Rat |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | EIF5 |
| eukaryotic translation initiation factor 5 |
| Anti-EIF5 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.2 mg/ml |
| Isotyp: | IgG |
| NCBI: | 1983 |
| UniProt: | P55010 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | MSVNVNRSVSDQFYRYKMPRLIAKVEGKGNGIKTVIVNMVDVAKALNRPPTYPTKYFGCELGAQTQFDVKNDRYIVNGSHEANKLQDMLDGFIKKFVLCPECENPETDLHVNPKKQTIGNSCKACGYRGMLDTHHKLCTFILKNPPENSD |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | EIF5 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line A-431 shows localization to cytosol. |
|
|
Immunohistochemical staining of human stomach shows strong cytoplasmic and membranous positivity in glandular cells. |
|
|
Western blot analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-EIF5 antibody. Remaining relative intensity is presented. |
|
|
Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells) Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells) |
|
|
HPA000867-100ul |
|
|
HPA000867-100ul |
|
|
HPA000867-100ul |
Produktgarantie und fachkundiger Support
