Anti-HNRNPH2
Artikelnummer:
ATA-HPA000914
- Bilder (6)
| Artikelname: | Anti-HNRNPH2 |
| Artikelnummer: | ATA-HPA000914 |
| Hersteller Artikelnummer: | HPA000914 |
| Alternativnummer: | ATA-HPA000914-100,ATA-HPA000914-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ICC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | FTP3, hnRNPH, HNRPH, HNRPH2 |
| heterogeneous nuclear ribonucleoprotein H2 (H) |
| Anti-HNRNPH2 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 3188 |
| UniProt: | P55795 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | DGRVTGEADVEFATHEDAVAAMAKDKANMQHRYVELFLNSTAGTSGGAYDHSYVELFLNSTAGASGGAYGSQMMGGMGLSNQSSYGGPASQQLSGGYGGGYGGQSSMSGYDQVLQ |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | HNRNPH2 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm. |
|
|
Western blot analysis in human cell line HeLa. |
|
|
Western blot analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue. |
|
|
HPA000914-100ul |
|
|
HPA000914-100ul |
|
|
HPA000914-100ul |
Produktgarantie und fachkundiger Support
