Anti-DTD2

Artikelnummer: ATA-HPA001117
Artikelname: Anti-DTD2
Artikelnummer: ATA-HPA001117
Hersteller Artikelnummer: HPA001117
Alternativnummer: ATA-HPA001117-100,ATA-HPA001117-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Sonstiges
Applikation: ICC, IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: C14orf126, MGC9912
D-tyrosyl-tRNA deacylase 2 (putative)
Anti-DTD2
Klonalität: Polyclonal
Konzentration: 0.1 mg/ml
Isotyp: IgG
NCBI: 112487
UniProt: Q96FN9
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: WVEVQRGLVIYVCFFKGADKELLPKMVNTLLNVKLSETENGKHVSILDLPGNILIIPQATLGGRLKGRNMQYHSNSGKEEGFELYSQFVTLCEKEVAANSKCAEARVVVEHGTYGNRQVLKLDTNGPFTHLIFE
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: DTD2
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:20 - 1:50
Immunofluorescent staining of human cell line SiHa shows localization to vesicles.
Immunohistochemical staining of human stomach shows moderate to strong cytoplasmic positivity in glandular cells.
Immunohistochemical staining of human cerebellum shows moderate cytoplasmic positivity in Purkinje cells.
Immunohistochemical staining of human placenta shows moderate cytoplasmic positivity in trophoblastic cells.
Immunohistochemical staining of human testis shows moderatemcytoplasmic positivity in cells in seminiferous ducts.
HPA001117-100ul
HPA001117-100ul
HPA001117-100ul