Anti-CKAP4
Artikelnummer:
ATA-HPA001225
- Bilder (6)
| Artikelname: | Anti-CKAP4 |
| Artikelnummer: | ATA-HPA001225 |
| Hersteller Artikelnummer: | HPA001225 |
| Alternativnummer: | ATA-HPA001225-100,ATA-HPA001225-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ICC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | CLIMP-63, ERGIC-63, P63 |
| cytoskeleton-associated protein 4 |
| Anti-CKAP4 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 10970 |
| UniProt: | Q07065 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | LKDLSDGIHVVKDARERDFTSLENTVEERLTELTKSINDNIAIFTEVQKRSQKEINDMKAKVASLEESEGNKQDLKALKEAVKEIQTSAKSREWDMEALRSTLQTMES |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | CKAP4 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line U-251 MG shows localization to nuclear speckles & cytosol. |
|
|
Western blot analysis using Anti-CKAP4 antibody HPA001225 (A) shows similar pattern to independent antibody HPA000278 (B). |
|
|
Western blot analysis in human cell line U-251 MG. |
|
|
HPA001225-100ul |
|
|
HPA001225-100ul |
|
|
HPA001225-100ul |
Produktgarantie und fachkundiger Support
