Anti-RGAG1

Artikelnummer: ATA-HPA001242
Artikelname: Anti-RGAG1
Artikelnummer: ATA-HPA001242
Hersteller Artikelnummer: HPA001242
Alternativnummer: ATA-HPA001242-100,ATA-HPA001242-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: KIAA1318, Mar9, Mart9
retrotransposon gag domain containing 1
Anti-RGAG1
Klonalität: Polyclonal
Konzentration: 0.2 mg/ml
Isotyp: IgG
NCBI: 57529
UniProt: Q8NET4
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: TSTLLMRDTASGVMSCPQMRSLASGALSKPLMTPKASGTMFTEKMTTTASEAMPTLLMRDTVSGALSMPQMTDTASGGLSASLMRDTASGAMSTSQMTATVSGGMSMPLMRAQDPGVMPASLMRAKVSGKMLSQPMSTQDPGGMSM
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: RGAG1
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:200 - 1:500
Immunohistochemistry analysis in human testis and kidney tissues using Anti-RGAG1 antibody. Corresponding RGAG1 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human testis shows high expression.
Immunohistochemical staining of human kidney shows low expression as expected.
HPA001242-100ul
HPA001242-100ul
HPA001242-100ul