Anti-CKB
Artikelnummer:
ATA-HPA001254
- Bilder (8)
| Artikelname: | Anti-CKB |
| Artikelnummer: | ATA-HPA001254 |
| Hersteller Artikelnummer: | HPA001254 |
| Alternativnummer: | ATA-HPA001254-100,ATA-HPA001254-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ICC, IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | CKBB |
| creatine kinase, brain |
| Anti-CKB |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 1152 |
| UniProt: | P12277 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | VISMQKGGNMKEVFTRFCTGLTQIETLFKSKDYEFMWNPHLGYILTCPSNLGTGLRAGVHIKLPNLGKHEKFSEVLKRLRLQKRGTGGVDTAAVGGVFDVSNADRLGFSEVELVQMVVDGVKLLIEMEQRLEQGQAIDDLMPAQK |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | CKB |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500 |
|
|
Immunofluorescent staining of human cell line HEK 293 shows localization to cytosol. |
|
|
Immunohistochemistry analysis in human cerebral cortex and pancreas tissues using Anti-CKB antibody. Corresponding CKB RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human cerebral cortex shows high expression. |
|
|
Immunohistochemical staining of human pancreas shows low expression as expected. |
|
|
HPA001254-100ul |
|
|
|
|
|
HPA001254-100ul |
|
|
HPA001254-100ul |
Produktgarantie und fachkundiger Support
