Anti-ERBB2

Artikelnummer: ATA-HPA001383
Artikelname: Anti-ERBB2
Artikelnummer: ATA-HPA001383
Hersteller Artikelnummer: HPA001383
Alternativnummer: ATA-HPA001383-100,ATA-HPA001383-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Sonstiges
Applikation: ICC, IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: CD340, HER-2, HER2, NEU, NGL
erb-b2 receptor tyrosine kinase 2
Anti-ERBB2
Klonalität: Polyclonal
Konzentration: 0.1 mg/ml
Isotyp: IgG
NCBI: 2064
UniProt: P04626
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: LPSETDGYVAPLTCSPQPEYVNQPDVRPQPPSPREGPLPAARPAGATLERPKTLSPGKNGVVKDVFAFGGAVENPEYLTPQGGAAPQPHPPPAFSPAFDNLYYWDQDPPERGAPPSTFKGTPTA
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: ERBB2
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:500 - 1:1000, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line MCF7 shows localization to plasma membrane.
Immunohistochemical staining of human breast cancer shows strong membranous positivity in tumor cells.
Immunohistochemical staining of human breast cancer shows no positivity in tumor cells as expected.
Western blot analysis in human cell line SK-BR-3.
HPA001383
HPA001383
HPA001383