Anti-CTCFL
Artikelnummer:
ATA-HPA001472
- Bilder (6)
| Artikelname: | Anti-CTCFL |
| Artikelnummer: | ATA-HPA001472 |
| Hersteller Artikelnummer: | HPA001472 |
| Alternativnummer: | ATA-HPA001472-100,ATA-HPA001472-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | BORIS, CT27, dJ579F20.2 |
| CCCTC-binding factor (zinc finger protein)-like |
| Anti-CTCFL |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 140690 |
| UniProt: | Q8NI51 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | DGVCREKDHRSPSELEAQRTSGAFQDSVLEEEVELVLAPSEESEKYILTLQTVHFTSEAVELQDMSLLSIQQQEGVQVVVQQPGPGLLWLEEGPRQSLQQCVAISIQQELYSPQEMEVLQFHALEENVMVASEDSKLAVS |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | CTCFL |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:200 - 1:500 |
|
|
Immunohistochemistry analysis in human testis and skeletal muscle tissues using HPA001472 antibody. Corresponding CTCFL RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human testis shows moderate nuclear positivity in cells in seminiferous ducts. |
|
|
Immunohistochemical staining of human skeletal muscle shows no positivity in myocytes as expected. |
|
|
HPA001472-100ul |
|
|
HPA001472-100ul |
|
|
HPA001472-100ul |
Produktgarantie und fachkundiger Support
