Anti-LGALS7
Artikelnummer:
ATA-HPA001549
- Bilder (8)
| Artikelname: | Anti-LGALS7 |
| Artikelnummer: | ATA-HPA001549 |
| Hersteller Artikelnummer: | HPA001549 |
| Alternativnummer: | ATA-HPA001549-100 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | GAL7, LGALS7A, PIG1, TP53I1 |
| lectin, galactoside-binding, soluble, 7 |
| Anti-LGALS7 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.05 mg/ml |
| Isotyp: | IgG |
| NCBI: | 3963 |
| UniProt: | P47929 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | PHKSSLPEGIRPGTVLRIRGLVPPNASRFHVNLLCGEEQGSDAALHFNPRLDTSEVVFNSKEQGSWGREERGPGVPFQRGQPFEVLIIASDDGFKAVVGDAQYHHFRHRLPLARVRLVEVGGDVQLDSV |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | LGALS7 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemical staining of human skin shows positivity in epidermal cells. |
|
|
Immunohistochemical staining of human cervix, uterine shows positivity in squamous epithelial cells. |
|
|
Immunohistochemical staining of human liver shows no positivity in hepatocytes as expected. |
|
|
Western blot analysis in human skin tissue. |
|
|
HPA001549-100ul |
|
|
|
|
|
HPA001549-100ul |
|
|
HPA001549-100ul |
Produktgarantie und fachkundiger Support
