Anti-CYB5R3

Artikelnummer: ATA-HPA001566
Artikelname: Anti-CYB5R3
Artikelnummer: ATA-HPA001566
Hersteller Artikelnummer: HPA001566
Alternativnummer: ATA-HPA001566-100,ATA-HPA001566-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: DIA1
cytochrome b5 reductase 3
Anti-CYB5R3
Klonalität: Polyclonal
Konzentration: 0.2 mg/ml
Isotyp: IgG
NCBI: 1727
UniProt: P00387
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: SGLLVYQGKGKFAIRPDKKSNPIIRTVKSVGMIAGGTGITPMLQVIRAIMKDPDDHTVCHLLFANQTEKDILLRPELEELRNKHSARFKLWYTLDRAPEAWDYGQGFVNEEMIRDHLPPPEEEPLVLMCGPPPMIQYACLPNLDH
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: CYB5R3
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:1000 - 1:2500, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line A-431 shows localization to endoplasmic reticulum.
Immunohistochemical staining of human testis shows strong cytoplasmic positivity in cells in seminiferus ducts and Leydig cells.
Lane 1: Marker [kDa] 206, 113, 82, 49, 32, 26, 18
Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp
Lane 4: Human cell line A-431
Lane 5: Human liver tissue
Lane 6: Human tonsil tissue
HPA001566-100ul
HPA001566-100ul
HPA001566-100ul