Anti-FBLN1 Antibody , Unconjugated, Rabbit, Polyclonal

Artikelnummer: ATA-HPA001613
Artikelname: Anti-FBLN1 Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer: ATA-HPA001613
Hersteller Artikelnummer: HPA001613
Alternativnummer: ATA-HPA001613-100,ATA-HPA001613-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: FBLN
fibulin 1
Anti-FBLN1
Klonalität: Polyclonal
Konzentration: 0.1 mg/ml
Isotyp: IgG
NCBI: 2192
UniProt: P23142
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: NTLGSYLCSCSVGFRLSVDGRSCEDINECSSSPCSQECANVYGSYQCYCRRGYQLSDVDGVTCEDIDECALPTGGHICSYRCINIPGSFQCSCPSSGYRLAPNGRNCQDIDECVTGIHNCSINETCFNIQGGFRCLAFECPEN
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: FBLN1
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml
Immunohistochemistry analysis in human cervix, uterine and liver tissues using Anti-FBLN1 antibody. Corresponding FBLN1 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human liver shows low expression as expected.
Immunohistochemical staining of human cervix, uterine shows high expression.
Western blot analysis in human cell lines HeLa and SK-MEL-30 using Anti-FBLN1 antibody. Corresponding FBLN1 RNA-seq data are presented for the same cell lines. Loading control: Anti-COX4I1.
Western blot analysis in control (vector only transfected HEK293T lysate) and FBLN1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY416606).
HPA001613
HPA001613
HPA001613