Anti-PAPPA
Artikelnummer:
ATA-HPA001667
- Bilder (8)
| Artikelname: | Anti-PAPPA |
| Artikelnummer: | ATA-HPA001667 |
| Hersteller Artikelnummer: | HPA001667 |
| Alternativnummer: | ATA-HPA001667-100,ATA-HPA001667-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | ASBABP2, DIPLA1, IGFBP-4ase, PAPA, PAPP-A, PAPPA1 |
| pregnancy-associated plasma protein A, pappalysin 1 |
| Anti-PAPPA |
| Klonalität: | Polyclonal |
| Konzentration: | 0.05 mg/ml |
| Isotyp: | IgG |
| NCBI: | 5069 |
| UniProt: | Q13219 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | SCLDHNSESIILPMNVTVRDIPHWLNPTRVERVVCTAGLKWYPHPALIHCVKGCEPFMGDNYCDAINNRAFCNYDGGDCCTSTVKTKKVTPFPMSCDLQGDCACRDPQAQEHSRKDL |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | PAPPA |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:50 - 1:200 |
|
|
Immunohistochemistry analysis in human placenta and skeletal muscle tissues using HPA001667 antibody. Corresponding PAPPA RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human placenta shows moderate to strong cytoplasmic positivity in trophoblastic cells. |
|
|
Immunohistochemical staining of human kidney shows moderate to strong cytoplasmic positivity in cells in tubules. |
|
|
Immunohistochemical staining of human endometrium shows moderate to strong cytoplasmic positivity in glandular cells. |
|
|
Immunohistochemical staining of human skeletal muscle shows no cytoplasmic positivity in myocytes as expected. |
|
|
HPA001667-100ul |
|
|
HPA001667-100ul |
|
|
HPA001667-100ul |
Produktgarantie und fachkundiger Support
