Anti-ARNT

Artikelnummer: ATA-HPA001759
Artikelname: Anti-ARNT
Artikelnummer: ATA-HPA001759
Hersteller Artikelnummer: HPA001759
Alternativnummer: ATA-HPA001759-100,ATA-HPA001759-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: bHLHe2, HIF-1beta
aryl hydrocarbon receptor nuclear translocator
Anti-ARNT
Klonalität: Polyclonal
Konzentration: 0.1 mg/ml
Isotyp: IgG
NCBI: 405
UniProt: P27540
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: RFSCLRPRVAGTTEMTSDVPSLGPAIASGNSGPGIQGGGAIVQRAIKRRPGLDFDDDGEGNSKFLRCDDDQMSNDKERFARSDDEQSSADKERLARENHSEIERRRRNKMTAYITELSDMV
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: ARNT
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200
Immunofluorescent staining of human cell line A-431 shows localization to nucleus & nuclear bodies.
Immunohistochemistry analysis in human placenta and pancreas tissues using Anti-ARNT antibody. Corresponding ARNT RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human placenta shows high expression.
Immunohistochemical staining of human pancreas shows low expression as expected.
HPA001759-100ul
HPA001759-100ul
HPA001759-100ul