Anti-SOD2
Artikelnummer:
ATA-HPA001814
- Bilder (7)
| Artikelname: | Anti-SOD2 |
| Artikelnummer: | ATA-HPA001814 |
| Hersteller Artikelnummer: | HPA001814 |
| Alternativnummer: | ATA-HPA001814-100,ATA-HPA001814-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human, Mouse, Rat |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | SOD2 |
| superoxide dismutase 2, mitochondrial |
| Anti-SOD2 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.2 mg/ml |
| Isotyp: | IgG |
| NCBI: | 6648 |
| UniProt: | None |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | VCGTSRQLAPVLGYLGSRQKHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWL |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | SOD2 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:1000 - 1:2500, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemical staining of human colon shows strong granular cytoplasmic positivity in glandular cells. |
|
|
Western blot analysis in human cell line U-87 MG. |
|
|
Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II. |
|
|
HPA001814-100ul |
|
|
|
|
|
HPA001814-100ul |
|
|
HPA001814-100ul |
Produktgarantie und fachkundiger Support
