Anti-PTK2

Artikelnummer: ATA-HPA001842
Artikelname: Anti-PTK2
Artikelnummer: ATA-HPA001842
Hersteller Artikelnummer: HPA001842
Alternativnummer: ATA-HPA001842-100,ATA-HPA001842-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Sonstiges
Applikation: ICC, IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: FADK, FAK, FAK1, PPP1R71
protein tyrosine kinase 2
Anti-PTK2
Klonalität: Polyclonal
Isotyp: IgG
NCBI: 5747
UniProt: Q05397
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: PEEGISYLTDKGCNPTHLADFTQVQTIQYSNSEDKDRKGMLQLKIAGAPEPLTVTAPSLTIAENMADLIDGYCRLVNGTSQSFIIRPQKEGERALPSIPKLANSEKQGMRTHAVSVSETDDYAEIIDEEDTYTMPSTRDYEIQRE
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: PTK2
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500
Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol & focal adhesion sites.
Immunohistochemical staining of human cerebellum shows moderate cytoplasmic positivity in Purkinje cells.
Immunohistochemical staining of human testis shows moderate to cytoplasmic positivity in spermatogonia and Leydig cells.
Immunohistochemical staining of human placenta shows moderate cytoplasmic positivity in decidual cells.
Immunohistochemical staining of human fallopian tube shows moderate cytoplasmic and membranous positivity in glandular cells.
HPA001842-100ul
HPA001842-100ul
HPA001842-100ul