Anti-VAV1

Artikelnummer: ATA-HPA001864
Artikelname: Anti-VAV1
Artikelnummer: ATA-HPA001864
Hersteller Artikelnummer: HPA001864
Alternativnummer: ATA-HPA001864-100,ATA-HPA001864-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: VAV
vav 1 guanine nucleotide exchange factor
Anti-VAV1
Klonalität: Polyclonal
Konzentration: 0.1 mg/ml
Isotyp: IgG
NCBI: 7409
UniProt: P15498
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: LSWTPIAQNRGIMPFPTEEESVGDEDIYSGLSDQIDDTVEEDEDLYDCVENEEAEGDEIYEDLMRSEPVSMPPKMTEYDKRCCCLREIQQTEEKYTDTLGSIQQHFLKPLQRFLKPQDIEIIFINIEDLLRVHTHFLKEMKEAL
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: VAV1
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:20 - 1:50
Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.
Immunohistochemistry analysis in human tonsil and pancreas tissues using Anti-VAV1 antibody. Corresponding VAV1 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human tonsil shows high expression.
Immunohistochemical staining of human pancreas shows low expression as expected.
HPA001864-100ul
HPA001864-100ul
HPA001864-100ul