Anti-MMP2

Artikelnummer: ATA-HPA001939
Artikelname: Anti-MMP2
Artikelnummer: ATA-HPA001939
Hersteller Artikelnummer: HPA001939
Alternativnummer: ATA-HPA001939-100,ATA-HPA001939-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: CLG4, CLG4A, TBE-1
matrix metallopeptidase 2 (gelatinase A, 72kDa gelatinase, 72kDa type IV collagenase)
Anti-MMP2
Klonalität: Polyclonal
Konzentration: 0.1 mg/ml
Isotyp: IgG
NCBI: 4313
UniProt: P08253
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: YGASPDIDLGTGPTPTLGPVTPEICKQDIVFDGIAQIRGEIFFFKDRFIWRTVTPRDKPMGPLLVATFWPELPEKIDAVYEAPQEEKAVFFAGNEYWIYSASTLERGYPKPLTSLGLPPDVQRVDAAFNWS
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: MMP2
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml
Immunohistochemical staining of human stomach shows moderate cytoplasmic positivity in glandular cells.
Western blot analysis in human cell line U-87 MG.
Western blot analysis in control (vector only transfected HEK293T lysate) and MMP2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY417923).
HPA001939-100ul
HPA001939-100ul
HPA001939-100ul