Anti-WAS
Artikelnummer:
ATA-HPA002022
- Bilder (6)
| Artikelname: | Anti-WAS |
| Artikelnummer: | ATA-HPA002022 |
| Hersteller Artikelnummer: | HPA002022 |
| Alternativnummer: | ATA-HPA002022-100,ATA-HPA002022-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | IMD2, THC, WASP |
| Wiskott-Aldrich syndrome |
| Anti-WAS |
| Klonalität: | Polyclonal |
| Konzentration: | 0.3 mg/ml |
| Isotyp: | IgG |
| NCBI: | 7454 |
| UniProt: | P42768 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | LQAGRLLWEQELYSQLVYSTPTPFFHTFAGDDCQAGLNFADEDEAQAFRALVQEKIQKRNQRQSGDRRQLPPPPTPANEERRGGLPPLPLHPGGDQGGPPVGPLSLGLATVDIQNPDITSSRYRGLPAPGPSPADKKRSGKK |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | WAS |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:200 - 1:500 |
|
|
Immunohistochemistry analysis in human appendix and kidney tissues using Anti-WAS antibody. Corresponding WAS RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human appendix shows high expression. |
|
|
Immunohistochemical staining of human kidney shows low expression as expected. |
|
|
HPA002022-100ul |
|
|
HPA002022-100ul |
|
|
HPA002022-100ul |
Produktgarantie und fachkundiger Support
