Anti-MBL2
Artikelnummer:
ATA-HPA002027
- Bilder (6)
| Artikelname: | Anti-MBL2 |
| Artikelnummer: | ATA-HPA002027 |
| Hersteller Artikelnummer: | HPA002027 |
| Alternativnummer: | ATA-HPA002027-100,ATA-HPA002027-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | COLEC1, MBL |
| mannose-binding lectin (protein C) 2, soluble |
| Anti-MBL2 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 4153 |
| UniProt: | P11226 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | DGDSSLAASERKALQTEMARIKKWLTFSLGKQVGNKFFLTNGEIMTFEKVKALCVKFQASVATPRNAAENGAIQNLIKEEAFLGITDEKTEGQFVDLTGNRLTYTNWNEGEPNNAGSDEDCVLLLKNGQWNDVPCSTSH |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | MBL2 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemical staining of human liver shows strong cytoplasmic positivity in hepatocytes. |
|
|
Western blot analysis in human cell line RT-4, human cell line U-251 MG, human cell line A-431, human liver tissue and human tonsil tissue. |
|
|
HPA002027-100ul |
|
|
|
|
|
HPA002027-100ul |
|
|
HPA002027-100ul |
Produktgarantie und fachkundiger Support
