Anti-PSMD14
Artikelnummer:
ATA-HPA002114
- Bilder (7)
| Artikelname: | Anti-PSMD14 |
| Artikelnummer: | ATA-HPA002114 |
| Hersteller Artikelnummer: | HPA002114 |
| Alternativnummer: | ATA-HPA002114-100,ATA-HPA002114-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ICC, IHC, WB |
| Spezies Reaktivität: | Human, Mouse, Rat |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | pad1, POH1, Rpn11 |
| proteasome (prosome, macropain) 26S subunit, non-ATPase, 14 |
| Anti-PSMD14 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.2 mg/ml |
| Isotyp: | IgG |
| NCBI: | 10213 |
| UniProt: | O00487 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | AVDTAEQVYISSLALLKMLKHGRAGVPMEVMGLMLGEFVDDYTVRVIDVFAMPQSGTGVSVEAVDPVFQAKMLDMLKQTGRPEMVVGWYHSHPGFGCWLSGVDINTQQSFEALSERAVAVVVDPIQSVKGKVVIDA |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | PSMD14 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & vesicles. |
|
|
Immunohistochemical staining of human hippocampus shows strong nuclear positivity in neuronal cells. |
|
|
Western blot analysis in human cell line HepG2. |
|
|
Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II. |
|
|
HPA002114-100ul |
|
|
HPA002114-100ul |
|
|
HPA002114-100ul |
Produktgarantie und fachkundiger Support
