Anti-CALR Antibody , Unconjugated, Rabbit, Polyclonal

Artikelnummer: ATA-HPA002242
Artikelname: Anti-CALR Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer: ATA-HPA002242
Hersteller Artikelnummer: HPA002242
Alternativnummer: ATA-HPA002242-100
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: cC1qR, CRT, FLJ26680, RO, SSA
calreticulin
Anti-CALR
Klonalität: Polyclonal
Konzentration: 0.05 mg/ml
Isotyp: IgG
NCBI: 811
UniProt: P27797
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: EQNIDCGGGYVKLFPNSLDQTDMHGDSEYNIMFGPDICGPGTKKVHVIFNYKGKNVLINKDIRCKDDEFTHLYTLIVRPDNTYEVKIDNSQVESGSLEDDWDFLPPKKIKDPDASKPEDWDERAKIDDPTDS
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: CALR
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml
Immunohistochemistry analysis in human thyroid gland and pancreas tissues using Anti-CALR antibody. Corresponding CALR RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human thyroid gland shows high expression.
Immunohistochemical staining of human pancreas shows low expression as expected.
Western blot analysis in human cell line HL-60.
Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
HPA002242
HPA002242
HPA002242