Anti-PLSCR4

Artikelnummer: ATA-HPA002276
Artikelname: Anti-PLSCR4
Artikelnummer: ATA-HPA002276
Hersteller Artikelnummer: HPA002276
Alternativnummer: ATA-HPA002276-100,ATA-HPA002276-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: PLSCR4
phospholipid scramblase 4
Anti-PLSCR4
Klonalität: Polyclonal
Konzentration: 0.1 mg/ml
Isotyp: IgG
NCBI: 57088
UniProt: Q9NRQ2
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: PQQPSTFPLYQPVGGIHPVRYQPGKYPMPNQSVPITWMPGPTPMANCPPGLEYLVQLDNIHVLQHFEPLEMMTCFETNNRYDIKNNSDQMVYIVTEDTDDFTRNAYRTLRPFVLRVTDCMGREIMTMQRPFRCTCCCFCCPSA
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: PLSCR4
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:20 - 1:50, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line SiHa shows localization to nucleoplasm & nuclear bodies.
Immunohistochemical staining of human cerebral cortex shows strong cytoplasmic positivity in neuropil and subset of glial cells.
Western blot analysis in human fallopian tube tissue.
HPA002276-100ul
HPA002276-100ul
HPA002276-100ul