Anti-LMAN1
Artikelnummer:
ATA-HPA002320
- Bilder (6)
| Artikelname: | Anti-LMAN1 |
| Artikelnummer: | ATA-HPA002320 |
| Hersteller Artikelnummer: | HPA002320 |
| Alternativnummer: | ATA-HPA002320-100,ATA-HPA002320-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | ERGIC-53, ERGIC53, F5F8D, FMFD1, gp58, MCFD1, MR60 |
| lectin, mannose-binding, 1 |
| Anti-LMAN1 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 3998 |
| UniProt: | P49257 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | IGNNGQIHYDHQNDGASQALASCQRDFRNKPYPVRAKITYYQNTLTVMINNGFTPDKNDYEFCAKVENMIIPAQGHFGISAATGGLADDHDVLSFLTFQLTEPGKEP |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | LMAN1 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:500 - 1:1000, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemical staining of human duodenum shows strong cytoplasmic positivity with granular pattern in glandular cells. |
|
|
Lane 1: Marker [kDa] 230, 110, 82, 49, 32, 26, 18 Lane 2: Human cell line RT-4 Lane 3: Human cell line U-251MG sp Lane 4: Human plasma (IgG/HSA depleted) Lane 5: Human liver tissue Lane 6: Human tonsil tissue |
|
|
HPA002320-100ul |
|
|
|
|
|
HPA002320-100ul |
|
|
HPA002320-100ul |
Produktgarantie und fachkundiger Support
