Anti-DPYSL2
Artikelnummer:
ATA-HPA002381
- Bilder (7)
| Artikelname: | Anti-DPYSL2 |
| Artikelnummer: | ATA-HPA002381 |
| Hersteller Artikelnummer: | HPA002381 |
| Alternativnummer: | ATA-HPA002381-100,ATA-HPA002381-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ICC, IHC, WB |
| Spezies Reaktivität: | Human, Mouse, Rat |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | CRMP2, DHPRP2, DRP-2, DRP2 |
| dihydropyrimidinase-like 2 |
| Anti-DPYSL2 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 1808 |
| UniProt: | Q16555 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | DFFQGTKAALAGGTTMIIDHVVPEPGTSLLAAFDQWREWADSKSCCDYSLHVDISEWHKGIQEEMEALVKDHGVNSFLVYMAFKDRFQLTDCQIYEVLSVIRDIGAIAQVHAENGDIIAEEQQRILDLGITGPEGHVLSR |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | DPYSL2 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:500 - 1:1000, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line U-2 OS shows localization to plasma membrane & cytosol. |
|
|
Immunohistochemical staining of human lung shows cytoplasmic and membranous positivity in pneumocytes. |
|
|
Western blot analysis in human cell line U-87 MG. |
|
|
Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II. |
|
|
HPA002381-100ul |
|
|
HPA002381-100ul |
|
|
HPA002381-100ul |
Produktgarantie und fachkundiger Support
