Anti-ABCC4

Artikelnummer: ATA-HPA002476
Artikelname: Anti-ABCC4
Artikelnummer: ATA-HPA002476
Hersteller Artikelnummer: HPA002476
Alternativnummer: ATA-HPA002476-100,ATA-HPA002476-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: EST170205, MOAT-B, MOATB, MRP4
ATP-binding cassette, sub-family C (CFTR/MRP), member 4
Anti-ABCC4
Klonalität: Polyclonal
Isotyp: IgG
NCBI: 10257
UniProt: O15439
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: NFSVGQRQLVCLARAILRKNQILIIDEATANVDPRTDELIQKKIREKFAHCTVLTIAHRLNTIIDSDKIMVLDSGRLKEYDEPYVLLQNKESLFYKMVQQLGKAEAAALTETAKQVYFKRNYPHIGHTDHMVTNTSNGQPST
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: ABCC4
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:200 - 1:500
Immunohistochemistry analysis in human prostate and endometrium tissues using Anti-ABCC4 antibody. Corresponding ABCC4 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human prostate shows high expression.
Immunohistochemical staining of human endometrium shows low expression as expected.
HPA002476-100ul
HPA002476-100ul
HPA002476-100ul