Anti-ERH Antibody , Unconjugated, Rabbit, Polyclonal

Artikelnummer: ATA-HPA002567
Artikelname: Anti-ERH Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer: ATA-HPA002567
Hersteller Artikelnummer: HPA002567
Alternativnummer: ATA-HPA002567-100,ATA-HPA002567-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: DROER
enhancer of rudimentary homolog (Drosophila)
Anti-ERH
Klonalität: Polyclonal
Konzentration: 0.1 mg/ml
Isotyp: IgG
NCBI: 2079
UniProt: P84090
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: LVQPTKRPEGRTYADYESVNECMEGVCKMYEEHLKRMNPNSPSITYDISQLFDFIDDLADLSCLVYRADTQTYQPYNKDWIKEKIYVLLRRQAQQAGK
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: ERH
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.
Immunohistochemical staining of human fallopian tube shows strong nuclear positivity in glandular cells.
Western blot analysis in human cell line A-431.
Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
HPA002567
HPA002567
HPA002567