Anti-NDUFB7
Artikelnummer:
ATA-HPA002817
- Bilder (6)
| Artikelname: | Anti-NDUFB7 |
| Artikelnummer: | ATA-HPA002817 |
| Hersteller Artikelnummer: | HPA002817 |
| Alternativnummer: | ATA-HPA002817-100,ATA-HPA002817-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human, Mouse, Rat |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | B18, CI-B18, MGC2480 |
| NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 7, 18kDa |
| Anti-NDUFB7 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.05 mg/ml |
| Isotyp: | IgG |
| NCBI: | 4713 |
| UniProt: | P17568 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | FPERKEREMVATQQEMMDAQLRLQLRDYCAHHLIRLLKCKRDSFPNFLACKQERHDWDYCEHRDYVMRMKEFERERRLLQRKKRREKKAAELAKGQGPGEVDPKV |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | NDUFB7 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemical staining of human heart muscle shows strong cytoplasmic positivity in myocytes. |
|
|
Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11 Lane 2: Human cell line RT-4 Lane 3: Human cell line U-251MG sp |
|
|
Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells) Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells) Lane 3: PC12 cell lysate (Pheochromocytoma of rat adrenal medulla) |
|
|
HPA002817-100ul |
|
|
HPA002817-100ul |
|
|
HPA002817-100ul |
Produktgarantie und fachkundiger Support
