Anti-AHNAK2

Artikelnummer: ATA-HPA002940
Artikelname: Anti-AHNAK2
Artikelnummer: ATA-HPA002940
Hersteller Artikelnummer: HPA002940
Alternativnummer: ATA-HPA002940-100,ATA-HPA002940-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: C14orf78
AHNAK nucleoprotein 2
Anti-AHNAK2
Klonalität: Polyclonal
Konzentration: 0.1 mg/ml
Isotyp: IgG
NCBI: 113146
UniProt: Q8IVF2
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: DAKDSKFKMPKFKMPSFRVSAPGESIEALVDVSELKVEADMSLPSMQGDLKTTDISIQPPSAQLEVQAGQVDVKLPEGHVPEGAGLKGHLPKLQMPSFKMPEVDLKG
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: AHNAK2
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500
Immunofluorescent staining of human cell line U-2 OS shows localization to plasma membrane & cytosol.
Immunohistochemistry analysis in human skin and skeletal muscle tissues using Anti-AHNAK2 antibody. Corresponding AHNAK2 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human skin shows high expression.
Immunohistochemical staining of human skeletal muscle shows low expression as expected.
HPA002940-100ul
HPA002940-100ul
HPA002940-100ul