Anti-DLST
Artikelnummer:
ATA-HPA003010
- Bilder (8)
| Artikelname: | Anti-DLST |
| Artikelnummer: | ATA-HPA003010 |
| Hersteller Artikelnummer: | HPA003010 |
| Alternativnummer: | ATA-HPA003010-100,ATA-HPA003010-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human, Mouse, Rat |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | DLTS |
| dihydrolipoamide S-succinyltransferase (E2 component of 2-oxo-glutarate complex) |
| Anti-DLST |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 1743 |
| UniProt: | P36957 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | QNTCAMLTTFNEIDMSNIQEMRARHKEAFLKKHNLKLGFMSAFVKASAFALQEQPVVNAVIDDTTKEVVYRDYIDISVAVATPRGLVVPVIRNVEAMNFADIERTITELGEKARKNELAIEDMDGGTFTISNGGVFGSLFGTPII |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | DLST |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemical staining of human liver shows strong cytoplasmic positivity in hepatocytes. |
|
|
Western blot analysis in MCF-7 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-DLST antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH. |
|
|
Western blot analysis in human cell line MCF-7. |
|
|
Western blot analysis in mouse cell line NIH-3T3, rat cell line NBT-II and rat cell line pC12. |
|
|
HPA003010-100ul |
|
|
|
|
|
HPA003010-100ul |
|
|
HPA003010-100ul |
Produktgarantie und fachkundiger Support
