Anti-RBM25
Artikelnummer:
ATA-HPA003025
- Bilder (8)
| Artikelname: | Anti-RBM25 |
| Artikelnummer: | ATA-HPA003025 |
| Hersteller Artikelnummer: | HPA003025 |
| Alternativnummer: | ATA-HPA003025-100,ATA-HPA003025-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ICC, IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | fSAP94, NET52, RNPC7, S164, Snu71 |
| RNA binding motif protein 25 |
| Anti-RBM25 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.5 mg/ml |
| Isotyp: | IgG |
| NCBI: | 58517 |
| UniProt: | P49756 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | PVDSVFNKFEDEDSDDVPRKRKLVPLDYGEDDKNATKGTVNTEEKRKHIKSLIEKIPTAKPELFAYPLDWSIVDSILMERRIRPWINKKIIEYIGEEEATLVDFVCSKVMAHSSPQSILDDVAMVLDEEAEV |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | RBM25 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:500 - 1:1000, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line A-431 shows localization to nuclear speckles. |
|
|
Immunohistochemical staining of human pancreas shows strong nuclear and moderate cytoplasmic positivity in exocrine glandular cells and Islet cells. |
|
|
Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10 Lane 2: Human cell line MOLT-4 |
|
|
|
|
|
|
|
|
HPA003025-100ul |
|
|
HPA003025-100ul |
|
|
HPA003025-100ul |
Produktgarantie und fachkundiger Support
