Anti-ZNF670
Artikelnummer:
ATA-HPA003142
- Bilder (6)
| Artikelname: | Anti-ZNF670 |
| Artikelnummer: | ATA-HPA003142 |
| Hersteller Artikelnummer: | HPA003142 |
| Alternativnummer: | ATA-HPA003142-100,ATA-HPA003142-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ICC, IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | MGC12466 |
| zinc finger protein 670 |
| Anti-ZNF670 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.2 mg/ml |
| Isotyp: | IgG |
| NCBI: | 93474 |
| UniProt: | Q9BS34 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | DVAVAFTQEEWALLDPSQKNLYRDVMQEIFRNLASVGNKSEDQNIQDDFKNPGRNLSSHVVERLFEIKEGSQYGETFSQDSNLNLNKKVSTGVKPC |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | ZNF670 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line A-431 shows positivity in cytoplasm, mitochondria & nucleus but excluded from the nucleoli. |
|
|
Immunohistochemical staining of human cerebral cortex shows strong nuclear positivity in neuronal cells and glial cells. |
|
|
Lane 1: Marker [kDa] 229, 112, 84, 48, 32, 27, 17 Lane 2: Human cell line RT-4 Lane 3: Human cell line U-251MG sp Lane 4: Human plasma (IgG/HSA depleted) Lane 5: Human liver tissue |
|
|
HPA003142-100ul |
|
|
HPA003142-100ul |
|
|
HPA003142-100ul |
Produktgarantie und fachkundiger Support
