Anti-MEIS2

Artikelnummer: ATA-HPA003256
Artikelname: Anti-MEIS2
Artikelnummer: ATA-HPA003256
Hersteller Artikelnummer: HPA003256
Alternativnummer: ATA-HPA003256-100,ATA-HPA003256-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Sonstiges
Applikation: ChIP, ICC, IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: HsT18361, MRG1
Meis homeobox 2
Anti-MEIS2
Klonalität: Polyclonal
Konzentration: 0.4 mg/ml
Isotyp: IgG
NCBI: 4212
UniProt: O14770
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: LEKVHELCDNFCHRYISCLKGKMPIDLVIDERDGSSKSDHEELSGSSTNLADHNPSSWRDHDDATSTHSAGTPGPSSGGHASQSGDNSSEQGDGLDNSV
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: MEIS2
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500
Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & cytosol.
Immunohistochemical staining of human liver shows low positivity in hepatocytes as expected.
Immunohistochemical staining of human prostate shows strong nuclear positivity in glandular and smooth muscle cells.
Immunohistochemical staining of human endometrium shows moderate nuclear positivity in glandular and stromal cells.
Immunohistochemical staining of human cerebral cortex shows strong nuclear positivity in neurons.
HPA003256-100ul
HPA003256-100ul
HPA003256-100ul