Anti-PHB
Artikelnummer:
ATA-HPA003280
- Bilder (7)
| Artikelname: | Anti-PHB |
| Artikelnummer: | ATA-HPA003280 |
| Hersteller Artikelnummer: | HPA003280 |
| Alternativnummer: | ATA-HPA003280-100,ATA-HPA003280-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ICC, IHC, WB |
| Spezies Reaktivität: | Human, Mouse, Rat |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | PHB1 |
| prohibitin |
| Anti-PHB |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 5245 |
| UniProt: | P35232 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | DVSLTHLTFGKEFTEAVEAKQVAQQEAERARFVVEKAEQQKKAAIISAEGDSKAAELIANSLATAGDGLIELRKLEAAEDIAYQLSRSRNITYLP |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | PHB |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line A-431 shows localization to mitochondria & vesicles. |
|
|
Immunohistochemical staining of human stomach shows strong cytoplasmic positivity, with a granular pattern, in glandular cells. |
|
|
Western blot analysis in human cell lines Caco-2 and HeLa using Anti-PHB antibody. Corresponding PHB RNA-seq data are presented for the same cell lines. Loading control: Anti-GAPDH. |
|
|
Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II. |
|
|
HPA003280-100ul |
|
|
HPA003280-100ul |
|
|
HPA003280-100ul |
Produktgarantie und fachkundiger Support
