Anti-RPL3
Artikelnummer:
ATA-HPA003365
- Bilder (6)
| Artikelname: | Anti-RPL3 |
| Artikelnummer: | ATA-HPA003365 |
| Hersteller Artikelnummer: | HPA003365 |
| Alternativnummer: | ATA-HPA003365-100,ATA-HPA003365-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ICC, IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | L3 |
| ribosomal protein L3 |
| Anti-RPL3 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 6122 |
| UniProt: | P39023 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | EDGKKQLEKDFSSMKKYCQVIRVIAHTQMRLLPLRQKKAHLMEIQVNGGTVAEKLDWARERLEQQVPVNQVFGQDEMIDVIGVTKGKGYKGVTSRWHTKKLPRKTHR |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | RPL3 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line A-431 shows localization to cytosol. |
|
|
Immunohistochemical staining of human cerebral cortex shows strong cytoplasmic and nuclear(nucleolar) positivity in neuronal cells. |
|
|
Lane 1: Marker [kDa] 220, 112, 84, 47, 32, 26, 17 Lane 2: Human cell line RT-4 Lane 3: Human cell line U-251MG sp |
|
|
HPA003365-100ul |
|
|
HPA003365-100ul |
|
|
HPA003365-100ul |
Produktgarantie und fachkundiger Support
