Anti-ITGA8
Artikelnummer:
ATA-HPA003432
- Bilder (7)
| Artikelname: | Anti-ITGA8 |
| Artikelnummer: | ATA-HPA003432 |
| Hersteller Artikelnummer: | HPA003432 |
| Alternativnummer: | ATA-HPA003432-100,ATA-HPA003432-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | ITGA8 |
| integrin, alpha 8 |
| Anti-ITGA8 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 8516 |
| UniProt: | P53708 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | HKEEEVGPLVEHIYELHNIGPSTISDTILEVGWPFSARDEFLLYIFHIQTLGPLQCQPNPNINPQDIKPAASPEDTPELSAFLRNSTIPHLVRKRDVHVVEFHRQSPAKILNCTNIECLQISCA |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | ITGA8 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:200 - 1:500 |
|
|
Immunohistochemical staining of human kidney shows strong membranous positivity in cells in glomeruli, while cells in tubules are negative. |
|
|
Immunohistochemical staining of human lung shows weak to moderate membranous positivity in pneumocytes. |
|
|
Immunohistochemical staining of human small intestine shows weak to moderate membranous positivity in smooth muscle cells. |
|
|
Immunohistochemical staining of human pancreas shows no positivity in exocrine glandular cells as expected. |
|
|
HPA003432-100ul |
|
|
HPA003432-100ul |
|
|
HPA003432-100ul |
Produktgarantie und fachkundiger Support
