Anti-SEPT6
Artikelnummer:
ATA-HPA003459
- Bilder (8)
| Artikelname: | Anti-SEPT6 |
| Artikelnummer: | ATA-HPA003459 |
| Hersteller Artikelnummer: | HPA003459 |
| Alternativnummer: | ATA-HPA003459-100,ATA-HPA003459-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | KIAA0128, MGC16619, MGC20339, SEP2, SEPT2 |
| septin 6 |
| Anti-SEPT6 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 23157 |
| UniProt: | Q14141 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | KSTSQGFCFNILCVGETGIGKSTLMDTLFNTKFESDPATHNEPGVRLKARSYELQESNVRLKLTIVDTVGFGDQINKDDSYKPIVEYIDAQ |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | SEPT6 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemical staining of human spleen shows moderate cytoplasmic positivity in cells in white pulp. |
|
|
Western blot analysis in human cell line SH-SY5Y. |
|
|
Lane 1: Marker [kDa] 230, 110, 82, 49, 32, 26, 18 Lane 2: Human cell line RT-4 Lane 3: Human cell line U-251MG sp Lane 4: Human plasma (IgG/HSA depleted) Lane 5: Human liver tissue Lane 6: Human tonsil tissue |
|
|
Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II. |
|
|
HPA003459-100ul |
|
|
|
|
|
HPA003459-100ul |
|
|
HPA003459-100ul |
Produktgarantie und fachkundiger Support
