Anti-NKX2-2 ChIP certified

Artikelnummer: ATA-HPA003468
Artikelname: Anti-NKX2-2 ChIP certified
Artikelnummer: ATA-HPA003468
Hersteller Artikelnummer: HPA003468
Alternativnummer: ATA-HPA003468-100,ATA-HPA003468-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: NKX2.2, NKX2B
NK2 homeobox 2
Anti-NKX2-2
Klonalität: Polyclonal
Konzentration: 0.2 mg/ml
Isotyp: IgG
NCBI: 4821
UniProt: O95096
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: SLTNTKTGFSVKDILDLPDTNDEEGSVAEGPEEENEGPEPAKRAGPLGQGALDAVQSLPLKNPFYDSSDNPYTRWLASTEGLQYSLHGLAAGAPPQDSSSKSPEPSADESPDNDKETP
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: NKX2-2
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:20 - 1:50, WB: 0.04-0.4 µg/ml
Immunohistochemical staining of human pancreas shows strong nuclear positivity in islet cells.
Western blot analysis in human cell line U-138 MG.
Western blot analysis in control (vector only transfected HEK293T lysate) and NKX2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY419283).
HPA003468-100ul
HPA003468-100ul
HPA003468-100ul