Anti-PBX1

Artikelnummer: ATA-HPA003505
Artikelname: Anti-PBX1
Artikelnummer: ATA-HPA003505
Hersteller Artikelnummer: HPA003505
Alternativnummer: ATA-HPA003505-100,ATA-HPA003505-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Sonstiges
Applikation: ICC, IHC, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: PBX1
pre-B-cell leukemia homeobox 1
Anti-PBX1
Klonalität: Polyclonal
Konzentration: 0.1 mg/ml
Isotyp: IgG
NCBI: 5087
UniProt: P40424
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: PRLMHSHAGVGMAGHPGLSQHLQDGAGGTEGEGGRKQDIGDILQQIMTITDQSLDEAQARKHALNCHRMKPALFNVLCEIKEKTVLSIRGAQEEEPTDPQLMRLDNMLLAEGV
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: PBX1
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm.
Immunohistochemical staining of human pancreas shows strong nuclear positivity in exocrine glandular cells.
Western blot analysis in human cell lines HeLa and SK-MEL-30 using Anti-PBX1 antibody. Corresponding PBX1 RNA-seq data are presented for the same cell lines. Loading control: Anti-COX4I1.
Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
HPA003505-100ul
HPA003505-100ul
HPA003505-100ul