Anti-GPX2
Artikelnummer:
ATA-HPA003545
- Bilder (6)
| Artikelname: | Anti-GPX2 |
| Artikelnummer: | ATA-HPA003545 |
| Hersteller Artikelnummer: | HPA003545 |
| Alternativnummer: | ATA-HPA003545-100,ATA-HPA003545-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | GSHPX-GI |
| glutathione peroxidase 2 (gastrointestinal) |
| Anti-GPX2 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 2877 |
| UniProt: | P18283 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | VLGFPCNQFGHQENCQNEEILNSLKYVRPGGGYQPTFTLVQKCEVNGQNEHPVFAYLKDKLPYPYDDPFSLMTDPKLIIWSPVRRSDVA |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | GPX2 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:50 - 1:200 |
|
|
Immunohistochemistry analysis in human gallbladder and pancreas tissues using Anti-GPX2 antibody. Corresponding GPX2 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human gallbladder shows high expression. |
|
|
Immunohistochemical staining of human pancreas shows low expression as expected. |
|
|
HPA003545-100ul |
|
|
HPA003545-100ul |
|
|
HPA003545-100ul |
Produktgarantie und fachkundiger Support
