Anti-STXBP6
Artikelnummer:
ATA-HPA003552
- Bilder (6)
| Artikelname: | Anti-STXBP6 |
| Artikelnummer: | ATA-HPA003552 |
| Hersteller Artikelnummer: | HPA003552 |
| Alternativnummer: | ATA-HPA003552-100,ATA-HPA003552-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | amisyn, HSPC156 |
| syntaxin binding protein 6 (amisyn) |
| Anti-STXBP6 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.4 mg/ml |
| Isotyp: | IgG |
| NCBI: | 29091 |
| UniProt: | Q8NFX7 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | NKKPTQASITKVKQFEGSTSFVRRSQWMLEQLRQVNGIDPNGDSAEFDLLFENAFDQWVASTASEKCTFFQILHHTCQRYLTDRKPEFINCQSKIMGGNSILHSAADSVTSAVQKASQALNERGERLGRAEEKTEDLK |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | STXBP6 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemical staining of human caudate shows strong positivity in neuronal cells. |
|
|
Western blot analysis in human cell lines Caco-2 and PC-3 using Anti-STXBP6 antibody. Corresponding STXBP6 RNA-seq data are presented for the same cell lines. Loading control: Anti-GAPDH. |
|
|
Western blot analysis in control (vector only transfected HEK293T lysate) and STXBP6 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY415452). |
|
|
HPA003552-100ul |
|
|
HPA003552-100ul |
|
|
HPA003552-100ul |
Produktgarantie und fachkundiger Support
