Anti-UBL4A
Artikelnummer:
ATA-HPA003617
- Bilder (6)
| Artikelname: | Anti-UBL4A |
| Artikelnummer: | ATA-HPA003617 |
| Hersteller Artikelnummer: | HPA003617 |
| Alternativnummer: | ATA-HPA003617-100,ATA-HPA003617-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human, Mouse, Rat |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | DXS254E, GDX, GET5, MDY2, TMA24, UBL4 |
| ubiquitin-like 4A |
| Anti-UBL4A |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 8266 |
| UniProt: | P11441 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | VSTLKQLVSEKLNVPVRQQRLLFKGKALADGKRLSDYSIGPNSKLNLVVKPLEKVLLEEGEAQRLADSPPPQVWQLISKVLARHFSAADASRVLEQLQRDYERSLSRLTLDDIERLASRFLHPEVTETMEKG |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | UBL4A |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemical staining of human cerebellum shows cytoplasmic positivity in purkinje cells. |
|
|
Western blot analysis in human cell line U-251 MG. |
|
|
Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II. |
|
|
HPA003617-100ul |
|
|
HPA003617-100ul |
|
|
HPA003617-100ul |
Produktgarantie und fachkundiger Support
