Anti-DNAL4
Artikelnummer:
ATA-HPA003647
- Bilder (7)
| Artikelname: | Anti-DNAL4 |
| Artikelnummer: | ATA-HPA003647 |
| Hersteller Artikelnummer: | HPA003647 |
| Alternativnummer: | ATA-HPA003647-100,ATA-HPA003647-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Molekularbiologie |
| Applikation: | ICC, IHC, WB |
| Spezies Reaktivität: | Human, Rat |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | dJ327J16, PIG27 |
| dynein, axonemal, light chain 4 |
| Anti-DNAL4 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.2 mg/ml |
| Isotyp: | IgG |
| NCBI: | 10126 |
| UniProt: | O96015 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | MGETEGKKDEADYKRLQTFPLVRHSDMPEEMRVETMELCVTACEKFSNNNESAAKMIKETMDKKFGSSWHVVIGEGFGFEITHEVKNLLYLYFGGTLAVCVWKCS |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | DNAL4 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line U-251 MG shows localization to centrosome. |
|
|
Immunohistochemical staining of human bronchus shows moderate positivity in cilia of respiratory epithelial cells. |
|
|
Lane 1: Marker [kDa] 230, 110, 82, 49, 32, 26, 18 Lane 2: Human cell line RT-4 Lane 3: Human cell line U-251MG sp |
|
|
Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells) Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells) |
|
|
HPA003647-100ul |
|
|
HPA003647-100ul |
|
|
HPA003647-100ul |
Produktgarantie und fachkundiger Support
