Anti-TAF10
Artikelnummer:
ATA-HPA004148
- Bilder (6)
| Artikelname: | Anti-TAF10 |
| Artikelnummer: | ATA-HPA004148 |
| Hersteller Artikelnummer: | HPA004148 |
| Alternativnummer: | ATA-HPA004148-100,ATA-HPA004148-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ChIP, ICC, IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | TAF2A, TAF2H, TAFII30 |
| TAF10 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 30kDa |
| Anti-TAF10 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.05 mg/ml |
| Isotyp: | IgG |
| NCBI: | 6881 |
| UniProt: | Q12962 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | SNGVYVLPSAANGDVKPVVSSTPLVDFLMQLEDYTPTIPDAVTGYYLNRAGFEASDPRIIRLISLAAQKFISDIANDALQHCKMKGTASGSSRSKSKDRKYTLTMEDLTPALSEYGINVKKP |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | TAF10 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:20 - 1:50 |
|
|
Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm. |
|
|
Immunohistochemical staining of human kidney shows nuclear positivity in cells in tubules nad cells in glomeruli. |
|
|
HPA004148-100ul |
|
|
|
|
|
HPA004148-100ul |
|
|
HPA004148-100ul |
Produktgarantie und fachkundiger Support
