Anti-TRIM33 Antibody , Unconjugated, Rabbit, Polyclonal

Artikelnummer: ATA-HPA004345
Artikelname: Anti-TRIM33 Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer: ATA-HPA004345
Hersteller Artikelnummer: HPA004345
Alternativnummer: ATA-HPA004345-100,ATA-HPA004345-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: FLJ11429, KIAA1113, PTC7, RFG7, TF1G, TIF1G, TIF1GAMMA, TIFGAMMA
tripartite motif containing 33
Anti-TRIM33
Klonalität: Polyclonal
Konzentration: 0.1 mg/ml
Isotyp: IgG
NCBI: 51592
UniProt: Q9UPN9
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: MQPHLQRQHSNPGHAGPFPVVSVHNTTINPTSPTTATMANANRGPTSPSVTAIELIPSVTNPENLPSLPDIPPIQLEDAGSSSLDNLLSRYISGSHLPPQPTSTMNPSPGPSALSPGSSGLSNSHTPVRPPSTSSTGSR
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: TRIM33
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm.
Immunohistochemical staining of human hippocampus shows strong nuclear positivity in neuronal cells.
Western blot analysis in human cell lines MCF-7 and HeLa using Anti-TRIM33 antibody. Corresponding TRIM33 RNA-seq data are presented for the same cell lines. Loading control: Anti-HSP90B1.
Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
HPA004345
HPA004345
HPA004345