Anti-ITGAX
Artikelnummer:
ATA-HPA004723
- Bilder (6)
| Artikelname: | Anti-ITGAX |
| Artikelnummer: | ATA-HPA004723 |
| Hersteller Artikelnummer: | HPA004723 |
| Alternativnummer: | ATA-HPA004723-100,ATA-HPA004723-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | CD11C |
| integrin, alpha X (complement component 3 receptor 4 subunit) |
| Anti-ITGAX |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 3687 |
| UniProt: | P20702 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | QDGLVDLAVGARGQVLLLRTRPVLWVGVSMQFIPAEIPRSAFECREQVVSEQTLVQSNICLYIDKRSKNLLGSRDLQSSVTLDLALDPGRLSPRATFQETKNRSLSRVRV |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | ITGAX |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:50 - 1:200 |
|
|
Immunohistochemistry analysis in human spleen and cerebral cortex tissues using Anti-ITGAX antibody. Corresponding ITGAX RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human spleen shows high expression. |
|
|
Immunohistochemical staining of human cerebral cortex shows low expression as expected. |
|
|
HPA004723-100ul |
|
|
HPA004723-100ul |
|
|
HPA004723-100ul |
Produktgarantie und fachkundiger Support
