Anti-HMGCL
Artikelnummer:
ATA-HPA004727
- Bilder (8)
| Artikelname: | Anti-HMGCL |
| Artikelnummer: | ATA-HPA004727 |
| Hersteller Artikelnummer: | HPA004727 |
| Alternativnummer: | ATA-HPA004727-100,ATA-HPA004727-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | HL |
| 3-hydroxymethyl-3-methylglutaryl-CoA lyase |
| Anti-HMGCL |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 3155 |
| UniProt: | P35914 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | GLQNEKNIVSTPVKIKLIDMLSEAGLSVIETTSFVSPKWVPQMGDHTEVLKGIQKFPGINYPVLTPNLKGFEAAVAAGAKEVVIFGAASELFTKKNINCSIEESFQRFDAILKAAQSANISVRGYVSCALGCPYEGKISPAK |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | HMGCL |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemistry analysis in human liver and skin tissues using Anti-HMGCL antibody. Corresponding HMGCL RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human liver shows high expression. |
|
|
Immunohistochemical staining of human skin shows low expression as expected. |
|
|
Lane 1: Marker [kDa] 229, 112, 84, 48, 32, 27, 17 Lane 2: Human cell line RT-4 |
|
|
HPA004727-100ul |
|
|
|
|
|
HPA004727-100ul |
|
|
HPA004727-100ul |
Produktgarantie und fachkundiger Support
