Anti-PGR

Artikelnummer: ATA-HPA004751
Artikelname: Anti-PGR
Artikelnummer: ATA-HPA004751
Hersteller Artikelnummer: HPA004751
Alternativnummer: ATA-HPA004751-100,ATA-HPA004751-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Sonstiges
Applikation: IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: NR3C3, PR
progesterone receptor
Anti-PGR
Klonalität: Polyclonal
Konzentration: 0.4 mg/ml
Isotyp: IgG
NCBI: 5241
UniProt: P06401
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: RVVRALDAVALPQPVGVPNESQALSQRFTFSPGQDIQLIPPLINLLMSIEPDVIYAGHDNTKPDTSSSLLTSLNQLGERQLLSVVKWSKS
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: PGR
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:200 - 1:500
Immunohistochemistry analysis in human endometrium and testis tissues using Anti-PGR antibody. Corresponding PGR RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human cerebral cortex, endometrium, fallopian tube and testis using Anti-PGR antibody HPA004751 (A) shows similar protein distribution across tissues to independent antibody HPA008428 (B).
Immunohistochemical staining of human endometrium shows high expression.
Immunohistochemical staining of human testis shows low expression as expected.
Immunohistochemical staining of human fallopian tube using Anti-PGR antibody HPA004751.
Immunohistochemical staining of human cerebral cortex using Anti-PGR antibody HPA004751.
HPA004751-100ul
HPA004751-100ul
HPA004751-100ul