Anti-GLI3
Artikelnummer:
ATA-HPA005534
- Bilder (6)
| Artikelname: | Anti-GLI3 |
| Artikelnummer: | ATA-HPA005534 |
| Hersteller Artikelnummer: | HPA005534 |
| Alternativnummer: | ATA-HPA005534-100,ATA-HPA005534-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | ACLS, GCPS, PAP-A, PAPA, PAPA1, PAPB, PHS, PPDIV |
| GLI family zinc finger 3 |
| Anti-GLI3 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 2737 |
| UniProt: | P10071 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | GQQMLGQISATSHINIYQGPESCLPGAHGMGSQPSSLAVVRGYQPCASFGGSRRQAMPRDSLALQSGQLSDTSQTCRVNGIKMEMKGQPHPLCSNLQNYSGQFYDQTVGFSQQDTKAGSFSISDASCLLQGTSAKNSELLSPGA |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | GLI3 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:50 - 1:200 |
|
|
Immunohistochemical staining of human spleen shows positivity in cells in red pulp. |
|
|
Immunohistochemical staining of human testis shows moderate nuclear positivity in cells in seminiferous ducts. |
|
|
Immunohistochemical staining of human pancreas shows no nuclear positivity in exocrine glandular cells as expected. |
|
|
HPA005534-100ul |
|
|
HPA005534-100ul |
|
|
HPA005534-100ul |
Produktgarantie und fachkundiger Support
