Anti-BCAM
Artikelnummer:
ATA-HPA005654
- Bilder (6)
| Artikelname: | Anti-BCAM |
| Artikelnummer: | ATA-HPA005654 |
| Hersteller Artikelnummer: | HPA005654 |
| Alternativnummer: | ATA-HPA005654-100,ATA-HPA005654-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ICC, IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | CD239, LU |
| basal cell adhesion molecule (Lutheran blood group) |
| Anti-BCAM |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 4059 |
| UniProt: | P50895 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | EVLNVNLEGNLTLEGVTRGQSGTYGCRVEDYDAADDVQLSKTLELRVAYLDPLELSEGKVLSLPLNSSAVVNCSVHGLPTPALRWTKDSTPLGDGPMLSLSSITFDSNGTYVCEASLPTVPVLSRTQNFTLLVQ |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | BCAM |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200 |
|
|
Immunofluorescent staining of human cell line A-431 shows localization to nucleoli fibrillar center. |
|
|
Immunohistochemical staining of human urinary bladder shows strong membranous and cytoplasmic positivity in basal layer of urothelium. |
|
|
HPA005654-100ul |
|
|
|
|
|
HPA005654-100ul |
|
|
HPA005654-100ul |
Produktgarantie und fachkundiger Support
