Anti-RPA3
Artikelnummer:
ATA-HPA005708
| Artikelname: |
Anti-RPA3 |
| Artikelnummer: |
ATA-HPA005708 |
| Hersteller Artikelnummer: |
HPA005708 |
| Alternativnummer: |
ATA-HPA005708-100,ATA-HPA005708-25 |
| Hersteller: |
Atlas Antibodies |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
IHC, WB |
| Spezies Reaktivität: |
Human |
| Immunogen: |
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: |
Unconjugated |
| Alternative Synonym: |
REPA3 |
| replication protein A3, 14kDa |
| Klonalität: |
Polyclonal |
| Konzentration: |
0.1 mg/ml |
| Isotyp: |
IgG |
| NCBI: |
6119 |
| UniProt: |
P35244 |
| Puffer: |
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: |
Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: |
VDMMDLPRSRINAGMLAQFIDKPVCFVGRLEKIHPTGKMFILSDGEGKNGTIELMEPLDEEISGIVEVVGRVTAKATILCTSYVQFKEDSHPFDLGLYNEAVKIIHDFPQFYP |
| Lagerung: |
Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: |
RPA3 |
| Antibody Type: |
Monoclonal Antibody |
| Application Verdünnung: |
IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml |
|
Immunohistochemical staining of human cerebral cortex shows strong nuclear and cytoplasmic positivity in neuronal cells. |
|
Western blot analysis in human cell line U-2 OS. |
|
Lane 1: Marker [kDa] 220, 112, 84, 47, 32, 26, 17 Lane 2: Human cell line RT-4 |
|
HPA005708-100ul |
|
HPA005708-100ul |
|
HPA005708-100ul |